Antibodies for $/€ 289

Jump to Filters
View as table Download
AlaRS (AARS) Rabbit Polyclonal Antibody
TA345782

USD 475.00

5 Days

Rabbit Polyclonal Anti-AARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AARS antibody: synthetic peptide directed towards the C terminal of human AARS. Synthetic peptide located within the following region: VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT
AlaRS (AARS) Rabbit Polyclonal Antibody
TA345783

USD 475.00

5 Days

Rabbit Polyclonal Anti-AARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AARS antibody: synthetic peptide directed towards the N terminal of human AARS. Synthetic peptide located within the following region: DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP