Antibodies for $/€ 289

Jump to Filters
View as table Download
ALS2 Rabbit Polyclonal Antibody
TA344753

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALS2 antibody: synthetic peptide directed towards the middle region of human ALS2. Synthetic peptide located within the following region: ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSG