Antibodies for $/€ 289

Jump to Filters
View as table Download
KIR2DL4 Rabbit Polyclonal Antibody
TA346319

USD 475.00

5 Days

Rabbit Polyclonal Anti-KIR2DL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR2DL4 antibody: synthetic peptide directed towards the middle region of human KIR2DL4. Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR