Antibodies for $/€ 289

Jump to Filters
View as table Download
NFYC Rabbit Polyclonal Antibody
TA343723

USD 475.00

5 Days

Rabbit Polyclonal Anti-NFYC Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFYC antibody: synthetic peptide directed towards the C terminal of human NFYC. Synthetic peptide located within the following region: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA
NFYC Rabbit Polyclonal Antibody
TA343722

USD 475.00

5 Days

Rabbit Polyclonal Anti-NFYC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFYC antibody is: synthetic peptide directed towards the N-terminal region of Human NFYC. Synthetic peptide located within the following region: EGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMK