Antibodies for $/€ 289

Jump to Filters
View as table Download
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA346440

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOT2 antibody: synthetic peptide directed towards the middle region of human ACOT2. Synthetic peptide located within the following region: SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR