Antibodies for $/€ 289

Jump to Filters
View as table Download
G protein beta 4 (GNB4) Rabbit Polyclonal Antibody
TA344722

USD 475.00

5 Days

Rabbit Polyclonal Anti-GNB4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB4 antibody: synthetic peptide directed towards the middle region of human GNB4. Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY