Antibodies for $/€ 289

Jump to Filters
View as table Download
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA344071

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF