Antibodies for $/€ 289

Jump to Filters
View as table Download
C4BPA Rabbit Polyclonal Antibody
TA346046

USD 475.00

5 Days

Rabbit Polyclonal Anti-C4BPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4BPA antibody: synthetic peptide directed towards the middle region of human C4BPA. Synthetic peptide located within the following region: QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL