Antibodies for $/€ 289

Jump to Filters
View as table Download
Factor X (F10) Rabbit Polyclonal Antibody
TA346197

USD 475.00

5 Days

Rabbit Polyclonal Anti-F10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F10 antibody: synthetic peptide directed towards the C terminal of human F10. Synthetic peptide located within the following region: STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ