Antibodies for $/€ 289

Jump to Filters
View as table Download
GSTA4 Rabbit Polyclonal Antibody
TA346702

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTA4 antibody: synthetic peptide directed towards the C terminal of human GSTA4. Synthetic peptide located within the following region: LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP