Antibodies for $/€ 289

Jump to Filters
View as table Download
Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody
TA346677

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR