Antibodies for $/€ 289

Jump to Filters
View as table Download
Liver Carboxylesterase 1 (CES1) Rabbit Polyclonal Antibody
TA346259

USD 410.00

5 Days

Rabbit Polyclonal Anti-CES1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES1 antibody: synthetic peptide directed towards the C terminal of human CES1. Synthetic peptide located within the following region: ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL