Antibodies for $/€ 289

Jump to Filters
View as table Download
Laminin 5 (LAMB3) Rabbit Polyclonal Antibody
TA346167

USD 475.00

5 Days

Rabbit Polyclonal Anti-LAMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3. Synthetic peptide located within the following region: ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD