Antibodies for $/€ 289

Jump to Filters
View as table Download
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA345670

USD 475.00

5 Days

Rabbit Polyclonal Anti-TUBA4A Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE
alpha Tubulin (TUBA4A) Rabbit Polyclonal Antibody
TA345671

USD 475.00

5 Days

Rabbit Polyclonal Anti-TUBA4A Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH