Antibodies for $/€ 289

Jump to Filters
View as table Download
Myosin light chain 3 (MYL3) Rabbit Polyclonal Antibody
TA346031

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG