Antibodies for $/€ 289

Jump to Filters
View as table Download
SETD7 Rabbit Polyclonal Antibody
TA346842

USD 410.00

5 Days

Rabbit Polyclonal Anti-SETD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETD7 antibody: synthetic peptide directed towards the C terminal of human SETD7. Synthetic peptide located within the following region: PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF