Antibodies for $/€ 289

Jump to Filters
View as table Download
POLR3F Rabbit Polyclonal Antibody
TA346754

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F. Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE
POLR3F Rabbit Polyclonal Antibody
TA346753

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the N terminal of human POLR3F. Synthetic peptide located within the following region: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR