Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-RPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Rabbit Polyclonal Anti-RPE Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPE antibody: synthetic peptide directed towards the middle region of human RPE. Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK