Antibodies for $/€ 289

Jump to Filters
View as table Download
DNA polymerase delta p50 (POLD2) Rabbit Polyclonal Antibody
TA346748

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT