Antibodies for $/€ 289

Jump to Filters
View as table Download
GH2 Rabbit Polyclonal Antibody
TA346316

USD 410.00

5 Days

Rabbit Polyclonal Anti-GH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC