Antibodies for $/€ 289

Jump to Filters
View as table Download
IRAKM (IRAK3) Rabbit Polyclonal Antibody
TA343776

USD 475.00

5 Days

Rabbit Polyclonal Anti-IRAK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRAK3 antibody: synthetic peptide directed towards the C terminal of human IRAK3. Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL