Antibodies for $/€ 289

Jump to Filters
View as table Download
MSH2 Rabbit Polyclonal Antibody
TA346018

USD 475.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
MSH2 Rabbit Polyclonal Antibody
TA346017

USD 410.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV