Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE |
Germany
Japan
United Kingdom
China
