Antibodies for $/€ 289

Jump to Filters
View as table Download
POLR3H Rabbit Polyclonal Antibody
TA346687

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL