Antibodies for $/€ 289

Jump to Filters
View as table Download
ME3 Rabbit Polyclonal Antibody
TA346684

USD 475.00

5 Days

Rabbit Polyclonal Anti-ME3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME3 antibody: synthetic peptide directed towards the N terminal of human ME3. Synthetic peptide located within the following region: PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD