Antibodies for $/€ 289

Jump to Filters
View as table Download
CNOT6 Rabbit Polyclonal Antibody
TA343830

USD 475.00

5 Days

Rabbit Polyclonal Anti-CNOT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN