Antibodies for $/€ 289

Jump to Filters
View as table Download
DCP1A Rabbit Polyclonal Antibody
TA345251

USD 410.00

5 Days

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI