Rabbit Polyclonal Anti-DIS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DIS3 antibody is: synthetic peptide directed towards the N-terminal region of Human DIS3. Synthetic peptide located within the following region: QTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENA |
Rabbit Polyclonal Anti-DIS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DIS3 antibody: synthetic peptide directed towards the N terminal of human DIS3. Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML |
Germany
Japan
United Kingdom
China