Antibodies for $/€ 289

Jump to Filters
View as table Download
RPLP0 Rabbit Polyclonal Antibody
TA345694

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPLP0 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPLP0 antibody: synthetic peptide directed towards the N terminal of human RPLP0. Synthetic peptide located within the following region: TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT
RPLP0 Rabbit Polyclonal Antibody
TA345695

USD 410.00

5 Days

Rabbit Polyclonal Anti-RPLP0 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPLP0 antibody: synthetic peptide directed towards the middle region of human RPLP0. Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY