Antibodies for $/€ 289

Jump to Filters
View as table Download
RPS24 Rabbit Polyclonal Antibody
TA345744

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPS24 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPS24 antibody: synthetic peptide directed towards the middle region of human RPS24. Synthetic peptide located within the following region: GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT