Antibodies for $/€ 289

Jump to Filters
View as table Download
TRM11 (TRMT11) Rabbit Polyclonal Antibody
TA346691

USD 475.00

5 Days

Rabbit Polyclonal Anti-TRMT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP