Rabbit Polyclonal Anti-LAMC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG |
Rabbit Polyclonal Anti-MAX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS |
Rabbit Polyclonal Anti-LAMB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3. Synthetic peptide located within the following region: ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD |
Rabbit Polyclonal Anti-LAMB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMB1 antibody: synthetic peptide directed towards the middle region of human LAMB1. Synthetic peptide located within the following region: VEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENL |
Germany
Japan
United Kingdom
China
