Antibodies for $/€ 289

Jump to Filters
View as table Download
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA344064

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE