Antibodies for $/€ 289

Jump to Filters
View as table Download
WNT5B Rabbit Polyclonal Antibody
TA344082

USD 410.00

5 Days

Rabbit Polyclonal Anti-WNT5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT