Rabbit Polyclonal Anti-PDHA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP |
Rabbit Polyclonal Anti-PDHA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the C terminal of human PDHA1. |
Rabbit Polyclonal Anti-PDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB. Synthetic peptide located within the following region: GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID |
Germany
Japan
United Kingdom
China
