Antibodies for $/€ 289

Jump to Filters
View as table Download
EIF4B Rabbit Polyclonal Antibody
TA345776

USD 475.00

5 Days

Rabbit Polyclonal Anti-EIF4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the middle region of human EIF4B. Synthetic peptide located within the following region: QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS