Antibodies for $/€ 289

Jump to Filters
View as table Download
BBS4 Rabbit Polyclonal Antibody
TA344647

USD 475.00

5 Days

Rabbit Polyclonal Anti-BBS4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BBS4 antibody: synthetic peptide directed towards the N terminal of human BBS4. Synthetic peptide located within the following region: YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAA
BBS4 Rabbit Polyclonal Antibody
TA344646

USD 475.00

5 Days

Rabbit Polyclonal Anti-BBS4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BBS4 antibody: synthetic peptide directed towards the middle region of human BBS4. Synthetic peptide located within the following region: LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC