Rabbit Polyclonal Anti-C19orf47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C19orf47 antibody: synthetic peptide directed towards the middle region of human C19orf47. Synthetic peptide located within the following region: YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT |
Rabbit Polyclonal Anti-C19orf47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C19orf47 antibody: synthetic peptide directed towards the C terminal of human C19orf47. Synthetic peptide located within the following region: DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMDHAGTVSVFKR |
Germany
Japan
United Kingdom
China