Rabbit Polyclonal Anti-MFN1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFN1 antibody: synthetic peptide directed towards the middle region of human MFN1. Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ |
Rabbit Polyclonal Anti-MFN1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MFN1 antibody is: synthetic peptide directed towards the N-terminal region of Human MFN1. Synthetic peptide located within the following region: SVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTV |
Germany
Japan
United Kingdom
China