Antibodies for $/€ 289

Jump to Filters
View as table Download
hnRNP L (HNRNPL) Rabbit Polyclonal Antibody
TA345781

USD 475.00

5 Days

Rabbit Polyclonal Anti-HNRPL Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
hnRNP L (HNRNPL) Rabbit Polyclonal Antibody
TA345708

USD 410.00

5 Days

Rabbit Polyclonal Anti-HNRPL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD