Antibodies for $/€ 289

Jump to Filters
View as table Download
Larp4b Rabbit Polyclonal Antibody
TA343825

USD 475.00

5 Days

Rabbit Polyclonal Anti-Larp4b Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Larp4b antibody is: synthetic peptide directed towards the middle region of Mouse Larp4b. Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY