Rabbit Polyclonal Anti-MBD3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD3 antibody: synthetic peptide directed towards the N terminal of human MBD3. Synthetic peptide located within the following region: SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN |
Rabbit Polyclonal Anti-Mbd3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mbd3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA |
Germany
Japan
United Kingdom
China