Antibodies for $/€ 289

Jump to Filters
View as table Download
RCC2 Rabbit Polyclonal Antibody
TA344837

USD 475.00

5 Days

Rabbit Polyclonal Anti-RCC2 Antibody - middle region

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RCC2 antibody: synthetic peptide directed towards the middle region of human RCC2. Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
RCC2 Rabbit Polyclonal Antibody
TA344838

USD 475.00

5 Days

Rabbit Polyclonal Anti-Rcc2 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rcc2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLSGVRVRTVVSGSCA