Antibodies for $/€ 289

Jump to Filters
View as table Download
Nmt2 Rabbit Polyclonal Antibody
TA346732

USD 475.00

5 Days

Rabbit Polyclonal Anti-Nmt2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nmt2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Nmt2. Synthetic peptide located within the following region: FDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ