Antibodies for $/€ 289

Jump to Filters
View as table Download
Rrp7a Rabbit Polyclonal Antibody
TA343832

USD 475.00

5 Days

Rabbit Polyclonal Anti-Rrp7a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rrp7a antibody is: synthetic peptide directed towards the C-terminal region of Rat Rrp7a. Synthetic peptide located within the following region: KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF