Antibodies for $/€ 289

Jump to Filters
View as table Download
Tbx18 Rabbit Polyclonal Antibody
TA345652

USD 475.00

5 Days

Rabbit Polyclonal Anti-Tbx18 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tbx18 antibody is: synthetic peptide directed towards the N-terminal region of RAT Tbx18. Synthetic peptide located within the following region: GPARSCTDAERSCASRGPAGSCEDGFLQGASPLASPGGSPKGSPVPGLAR