Rabbit Polyclonal Anti-AKT1S1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1S1 antibody: synthetic peptide directed towards the C terminal of human AKT1S1. Synthetic peptide located within the following region: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE |
Rabbit Polyclonal Anti-Akt1s1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Akt1s1 antibody is: synthetic peptide directed towards the middle region of Rat Akt1s1. Synthetic peptide located within the following region: DEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQDLPPFCESDPESTD |
Germany
Japan
United Kingdom
China