Rabbit Polyclonal Anti-MRPS15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the middle region of human MRPS15. Synthetic peptide located within the following region: QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMS |
Rabbit Polyclonal Anti-MRPS15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the N terminal of human MRPS15. Synthetic peptide located within the following region: FNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEK |
Rabbit Polyclonal Anti-MRPS15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the C terminal of human MRPS15. Synthetic peptide located within the following region: RRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIP |
Germany
Japan
United Kingdom
China