Primary Antibodies

Jump to Filters
View as table Download
HIC2 Rabbit Polyclonal Antibody
TA329406

USD 375.00

5 Days

Rabbit Polyclonal anti-HIC2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC