Rabbit polyclonal anti-CREB-BP antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CREB-BP. |
Rabbit polyclonal anti-CREB-BP antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human CREB-BP. |
KAT3A / CBP (CREBBP) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-CREBBP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CREBBP Antibody: synthetic peptide directed towards the N terminal of human CREBBP. Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS |
Anti-CREBBP Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 160-176 amino acids of Human |